PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6581_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 294aa    MW: 33071.7 Da    PI: 6.046
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6581_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-173178148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  cra_locus_6581_iso_1_len_1032_ver_3 31 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 78
                                         79******************************99************97 PP

2Myb_DNA-binding461.2e-1484129148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  cra_locus_6581_iso_1_len_1032_ver_3  84 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 129
                                          89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-242281IPR009057Homeodomain-like
PROSITE profilePS5129425.0752682IPR017930Myb domain
SuperFamilySSF466891.08E-3028125IPR009057Homeodomain-like
SMARTSM007172.4E-143080IPR001005SANT/Myb domain
PfamPF002492.7E-163178IPR001005SANT/Myb domain
CDDcd001672.12E-113378No hitNo description
Gene3DG3DSA:1.10.10.609.5E-2582134IPR009057Homeodomain-like
SMARTSM007173.5E-1383131IPR001005SANT/Myb domain
PROSITE profilePS5129418.96583133IPR017930Myb domain
PfamPF002494.8E-1384129IPR001005SANT/Myb domain
CDDcd001672.83E-986129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
KSTHKVEEAE EKEIIINMGR PPCCDKVGIK KGPWTPEEDI ILVSYIQEHG PGNWRSVPTN  60
TGLLRCSKSC RLRWTNYLRP GIKRGNFTPH EEGMIIHLQA LLGNKWAAIA SYLPQRTDND  120
IKNYWNTHLK KKIKKFQSNL DPQISSNINL TPQPSFQFVS KSFNESNTED GKVNTTSSSV  180
YASSAENISR LLEGWMRSSS SNSNSSPKNS GFHHQNGGND DDQVVGNGTV CKHEFDSLDN  240
LDYGNNNHDD DDDDQEKKLG KVENIVNPPP LSFLENWLLD ETIGQEVMGI PSIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-242913325128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240570.11e-114PREDICTED: myb-related protein 306
SwissprotP813922e-93MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A068UWH91e-117A0A068UWH9_COFCA; Uncharacterized protein
STRINGVIT_08s0056g00800.t011e-110(Vitis vinifera)